PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA46G00051
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family bZIP
Protein Properties Length: 944aa    MW: 103501 Da    PI: 7.1952
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA46G00051genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.63.7e-10377435563
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                 kr +r   NR +A rs +RK  +i eLe kv++L++e ++L  +l  l+  +  l++++
  AA46G00051 377 KRVKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQLTLLQRDSMGLTNQN 435
                 999******************************************99998877777665 PP

2bZIP_132.81.5e-10835893563
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                 kr ++   NR +A rs +RK  +i+eLe kv++L++e ++L  +l +l+  +  l+s++
  AA46G00051 835 KRVKKILANRQSAARSKERKMRYIAELEHKVQTLQTETTTLSAQLTHLQRDSMGLTSQN 893
                 899999******************************************99998888887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-18373437IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.726375438IPR004827Basic-leucine zipper domain
PfamPF001705.2E-9377434IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.6E-11377434No hitNo description
SuperFamilySSF579592.6E-11377433No hitNo description
CDDcd147031.61E-23378427No hitNo description
SMARTSM003384.5E-18831895IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.588833896IPR004827Basic-leucine zipper domain
PfamPF001705.4E-9835893IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.74E-11835890No hitNo description
Gene3DG3DSA:1.20.5.1702.6E-9835892No hitNo description
CDDcd147031.11E-15836885No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 944 aa     Download sequence    Send to blast
MNQQLDIPHL NPNHFRSQPF SNGGGDSGKR AGVPPSHPGL IPPISPYSQI PVSRQSGSQN  60
FSPGPSHSRS MSQPSPFFSF DSLPPLSPSP FRDSPSASVA DHDVSMEDRD SAGFNNASLP  120
PSPFTRCNSL RSSGGGSSSL PPRKAHRRSN SDIPFGLMAQ NSPPLIPPRP LERSISGGEG  180
KDWSNMANFV KRETSNGEKE GVGERKSEGE AMDDLFSAYM NLENIDVLNS SEADDSKNGD  240
ENGEDMESSR ASGTKTNGGN SSDTEGESSV NESGNKIRTR EGLKRRAGGD IAPTSRHYRS  300
VSMDSCFIGK LNFGDESPSK PIPSPGNLSG KASPTESLDG NASAFSLEFG NGEFTATEMK  360
KIMANDKLAE IAASDPKRVK RILANRQSAA RSKERKMRYI SELEHKVQTL QTEATTLSAQ  420
LTLLQRDSMG LTNQNNELKF CLQAMEQQAR LGDALNEQLS AEVQRLKLAT GEVCHNNRSG  480
ANSESKMQSL NAKMFQQLNI SQLHQLQSSQ SKDSNENKTI KTKPESHEQT PPSHPNPNPI  540
HLISPHCQIP ATLQPISENF NPGSRHSRSM SQPSSFFSFD SVPVFNPSPM EERNGNGGFK  600
PSLPPSPFTM CQSSSSSSSS KVVSNGENLP PRKSHRRSNS DNIPFGFSSL MDQKLPPLIP  660
SRSLEISDWS NLVKEEPINE KGNNKSSEGE TMDDIFSAYM NLDNIEVLNS LGGENIKEEI  720
DRNGESCSDS EEQVKISVKR RASKDIASTS RHHKRSVSMD SCFMEKLNFN EDSSLKPLKL  780
SSPGNLSAKV SPSSSADGNS SGFNIEFGNT EFTAMEIKKI KTDEKLAEIA MTDPKRVKKI  840
LANRQSAARS KERKMRYIAE LEHKVQTLQT ETTTLSAQLT HLQRDSMGLT SQNSELKFRI  900
QAMEQQALLR DALKDRLSAE VQRLRMVNGE AMSELEISKR LMNE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010531490.10.0PREDICTED: probable transcription factor PosF21
RefseqXP_010531491.10.0PREDICTED: probable transcription factor PosF21
TrEMBLQ8H1F00.0Q8H1F0_ARATH; Basic-leucine zipper (BZIP) transcription factor family protein
STRINGAT4G38900.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42242757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.30.0bZIP family protein